PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Brast08G044400.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family WRKY
Protein Properties Length: 223aa    MW: 23275.7 Da    PI: 7.1246
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Brast08G044400.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY97.59e-31135192158
                         ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS CS
                WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnh 58 
                         ldDgy+WrKYG+K+vk+s++pr+YYrC+++gC+vkk+ver+++dp++v++tYeg+H h
  Brast08G044400.1.p 135 LDDGYKWRKYGKKSVKNSPNPRNYYRCSTEGCSVKKRVERDRDDPSYVVTTYEGTHSH 192
                         59*******************************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.802.8E-33121195IPR003657WRKY domain
SuperFamilySSF1182906.41E-28127195IPR003657WRKY domain
PROSITE profilePS5081131.215130195IPR003657WRKY domain
SMARTSM007742.0E-34135194IPR003657WRKY domain
PfamPF031061.2E-24136192IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009867Biological Processjasmonic acid mediated signaling pathway
GO:0042742Biological Processdefense response to bacterium
GO:0050832Biological Processdefense response to fungus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 223 aa     Download sequence    Send to blast
MAAVGAAPVL FYQQPALAAG DGAGCFFGPP SSPPMSSFFS SHGHGGSSST AGSSPASAFS  60
PALPAPPPPA AADPGQFDIS EYLFDDGIFA AVPPGAPAVA AHGGSAADQQ QQAAAVERPR  120
TERIAFRTRS EIEILDDGYK WRKYGKKSVK NSPNPRNYYR CSTEGCSVKK RVERDRDDPS  180
YVVTTYEGTH SHVSPSTVYY ASQDAASGRF FVAGTQPPGS LH*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj2_A2e-25125196778Probable WRKY transcription factor 4
2lex_A2e-25125196778Probable WRKY transcription factor 4
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankCT8378811e-145CT837881.1 Oryza sativa (indica cultivar-group) cDNA clone:OSIGCRA124O14, full insert sequence.
GenBankDQ2981791e-145DQ298179.1 Oryza sativa WRKY transcription factor 7 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003568011.11e-96PREDICTED: probable WRKY transcription factor 48
SwissprotQ93WU96e-42WRK51_ARATH; Probable WRKY transcription factor 51
TrEMBLI1HH541e-96I1HH54_BRADI; Uncharacterized protein
STRINGBRADI2G18530.13e-96(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP44137206
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G26170.15e-41WRKY DNA-binding protein 50